DPCstruct | MC6338
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 57 ± 4 aa |
| Standard deviation of domain lengths | 4.27 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 73.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2M7Z0 | 37-97 | LVDRGDVETNECLENNGGCWQDKTVNLTACRDTFRGRVCECLLVDGVQFKGDGYSHCEGPN |
| B9TFP0 | 90-146 | LSSDLETNECLERNGGCWQDKQSNVTACKDTFRGRICECPVVKGVQYRGDGYASCEG |
| A0A287H803 | 342-396 | None |
| A0A5J5ST26 | 289-348 | None |
| A0A835KC57 | 909-963 | None |
| A0A498JXI7 | 482-538 | None |
| A0A7G2EYX9 | 413-465 | None |
| A0A287R2B9 | 353-406 | None |
| A0A7J8X5G0 | 1-53 | None |
| A0A7J8LUG8 | 12-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.