DPCstruct | MC63378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 276 ± 55 aa |
| Standard deviation of domain lengths | 55.44 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I4C1E5 | 15-220 | MVKAQERIHALHRVLGAFDSYNALLDSELPAKHLLHDENVADKISRRLLQPTSGKGNDQVCQWLFDTYQTQDPALQLVVLRFLPVLC… |
| A0A7J7WGM0 | 15-260 | EFKALPDTQITNYAATLHRKKTLVPALYKVIQDSNNELLEPVCHQLFELYRSSEVRLKRFTLQFLPELMWVYLRLTVSRDRQSNGCI… |
| A0A162Q6K6 | 10-218 | None |
| A0A7J7FI92 | 64-265 | None |
| A0A835HJK9 | 6-236 | None |
| F4Q4X4 | 151-390 | None |
| B0E6P8 | 17-260 | None |
| A0A7S4PJM6 | 22-288 | None |
| A0A6P6FQI2 | 2-236 | None |
| A0A4U6SSJ8 | 5-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.