DPCstruct | MC63374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 103 ± 3 aa |
| Standard deviation of domain lengths | 3.04 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 94.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 44.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4ASW4 | 19-118 | FNAIPQIDKCTENGYPLEEMKMVHETRKIMGDESIEVTAICVRIPVVRGILNPCMWEFKNDDDLEDVQRLLSNAPGVTLVEDPSFQS… |
| A0A7V5IFJ6 | 91-197 | KVEVYPHQIAFNCLPHIDVFFPNGYTKEEMKMINETKKILSDDSIAVTATTVRVPVLYGHSESVNIETEKKLSPEEVREILSKAPGV… |
| A0A7K0F6F9 | 1-102 | None |
| A0A7V1RCZ7 | 28-131 | None |
| A0A4Y1QRZ0 | 51-151 | None |
| A0A7R8ZYK3 | 174-281 | None |
| A0A5P1EG00 | 122-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.