DPCstruct | MC6337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 51 ± 1 aa |
| Standard deviation of domain lengths | 0.90 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 88.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 75.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9KCL4 | 1-52 | MVLLQLNLKPGSIVVETGTGSGSMSHAIMRTIAPTGHLYTFEFHEQRAKLAR |
| A0A5D2M3E2 | 1-51 | MFIVPGCLVLESGTGSGSLTTLFARAVAPTGHVYTFDFHEQRAASARRHVL |
| A0A2P5WT30 | 147-197 | None |
| A0A6P4PVI2 | 3-51 | None |
| A2WPI8 | 111-161 | None |
| A0A5D2XRW6 | 70-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.