DPCstruct | MC63369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 124 ± 19 aa |
| Standard deviation of domain lengths | 18.59 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.69 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0181- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A135S920 | 16-125 | QPTITSLQDLTLIEAWDNDANAPKYVTFYHITDEAELWFGQSSKNKREIPLEEYQEALELVPDEEIYPEIPTGAKLTIAPDNIDDPV… |
| A0A428REC0 | 148-270 | LKPPAVNDFKDFTICNEVDELDDTDECVSTYTLVMIVDQDNYSAWIGTVNAPRDQVSLEQAVNCLSRIPDEAIYPPVTPGMQAIATC… |
| A0A1Y1VVG4 | 1-133 | None |
| A0A842YUE8 | 41-197 | None |
| A0A1B7YCF4 | 2-104 | None |
| A0A168CAD0 | 11-95 | None |
| A0A2P4Z8L2 | 29-152 | None |
| A0A1B7MT17 | 1-152 | None |
| A0A6G1FV47 | 34-169 | None |
| A0A6A6P5A7 | 26-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.