DPCstruct | MC63368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 325 ± 51 aa |
| Standard deviation of domain lengths | 51.46 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A135S3C9 | 2-287 | NVDFGVLPPAGDPHLHDRARLRRQIYERSYDNSTDIPKAVDCKYLSRDAPASSNQRHLQVLEIVNFLRTWPQKATTTQCLAQQLSQN… |
| X0BYR4 | 2-237 | AFRAYNKLPTFSESLFADFAQHLYALLSSESTISDRAIPPREDMLYDSNWLKNPTNFLSSYWCRLHHAFQHNHIWLNKFELMVWIAT… |
| A0A0C9U2A6 | 243-601 | None |
| A0A175VPI5 | 765-1040 | None |
| A0A5N6E5R1 | 14-388 | None |
| A0A2K0UV93 | 165-506 | None |
| A0A2K0USD6 | 382-749 | None |
| A0A7R7WCC1 | 164-529 | None |
| A0A1J8Q2Q5 | 575-881 | None |
| A0A1E3BNG3 | 1-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.