DPCstruct | MC63367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 305 ± 64 aa |
| Standard deviation of domain lengths | 63.67 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12366 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6IDG2 | 257-570 | QEEYKQRECESVSVCEEETKVEEQGDIEVQMSFVQEESEATKCKLEMKLLSEAVFAGKHWQTDGISNVLYQSEERLITFSLETFGPV… |
| A0A7S3CKL6 | 69-355 | SVQTTYRLAEYVYLTEKDEIKVGVWDSDANCWSTDYIEDLNYDKEKRELNFKTRKFAPIAFLQPKTTDYPYDSWDIRCVADQLALLQ… |
| A0A2G8L0P4 | 1-217 | None |
| A0A6H5GUP5 | 527-880 | None |
| A0A2I4D8V5 | 302-635 | None |
| A0A6I9YS90 | 266-504 | None |
| A0A813Q836 | 47-234 | None |
| A0A182IT97 | 599-931 | None |
| A0A2K1KNZ8 | 139-490 | None |
| A0A6A4W6J1 | 239-568 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.