DPCstruct | MC63361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 356 ± 74 aa |
| Standard deviation of domain lengths | 73.54 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 34.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287KW22 | 2-362 | NQISSFEAKVANGNGEQTLSRDIYRLGRRFDFYRMLSFYFTTVGFYFSSMVTVLTVYVFLYGRLYLVMSGLEKSIVLDPRVKDDIKP… |
| C4YF31 | 35-481 | SILNFTTKIGAGMGEQMLSREYFYLGTQLPLDRFLSFYYGHPGFHINNLFIQLSLQVFILVLANLNSLAHEAIMCSYNKDVPVTDVL… |
| A0A7J8NDA4 | 7-217 | None |
| A0A812MNB3 | 2-458 | None |
| A0A812ISX6 | 278-733 | None |
| A0A6A3UIE4 | 420-805 | None |
| A0A164XH93 | 22-418 | None |
| A0A0L9V9W1 | 737-1146 | None |
| M7YG11 | 61-518 | None |
| A0A7S2JUY3 | 514-904 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.