DPCstruct | MC6336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 163 ± 19 aa |
| Standard deviation of domain lengths | 19.37 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 48.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821AZ56 | 186-340 | MRSYGCHVCSRPALPPMFEHRLWNAWDMALDLCLKQLPSVLKQTESGIREPIYEPSSFFADQLTAFSVWLGENSLLTATLEKEHLKQ… |
| A0A2G8JU68 | 350-489 | MRSYNCTPISSPQLPPTYQHPMWQAWDLAVDISLSQLPDLIKGGDYQHSPFFAEQLTAFQVWLTIGCEGRQPPEQLPIVLQVLLSQV… |
| S9U188 | 298-450 | None |
| A0A2H2JLR4 | 208-411 | None |
| Q68TI8 | 415-593 | None |
| A0A2X0MCA3 | 483-651 | None |
| A0A3P7IEN9 | 241-416 | None |
| A0A662Y446 | 71-215 | None |
| A0A5E4M464 | 50-194 | None |
| A0A0N4UBB1 | 371-545 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.