DPCstruct | MC63359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 360 ± 28 aa |
| Standard deviation of domain lengths | 28.07 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14816 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287KP84 | 5-319 | GWLMKLVALYGSVEDSIASWALTALLYSSNKKLQDSASEFWDSLLSLNEDDKPSVNFGYFPSYSILKDAVLNYGYLHDAPWSKTCTS… |
| A0A0E9NFX3 | 215-538 | GFMRSTLSLGKVLPDELLMWLLDEVYYETSEELVDAYVDYIVEAAKKHPNTFQKLLSADRFQRMLINLGVSANAMGQGTKVYPVLQN… |
| A0A6P8QLD7 | 475-860 | None |
| A0A7J7J463 | 220-592 | None |
| M5G2N2 | 801-1140 | None |
| A0A1C7NPH6 | 179-509 | None |
| N1QLY3 | 3-364 | None |
| A0A5M3Z396 | 300-638 | None |
| A0A7F8QTV6 | 278-643 | None |
| K7LQB0 | 1-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.