DPCstruct | MC63343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 654 ± 109 aa |
| Standard deviation of domain lengths | 109.44 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 20.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C6WP83 | 12-658 | TTFRFALLVLVAVSVAGTLFLASFPGEGEATARLLGCLGVDPERYDEVPACADSALSGAWAWVTWWMAGFLLLALLLRAGDPRWRIR… |
| A0A0A8EG92 | 110-810 | TGPRFALLIILVTASSFATLTSVLDQLSVPSESGRPGAGLYGTPSCLYAAGFDPAGSDLGNIRATMSRPDALLKCLGDRPVGYRALI… |
| A0A4D4M8M9 | 1-547 | None |
| A0A0N1GVT6 | 25-837 | None |
| A0A504LEY4 | 17-505 | None |
| A0A7W7USK6 | 26-706 | None |
| A0A366LRN7 | 2-700 | None |
| A0A561EKY1 | 1-724 | None |
| A0A1Q4VW03 | 11-866 | None |
| A0A561TSP1 | 31-637 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.