DPCstruct | MC6334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 225 ± 50 aa |
| Standard deviation of domain lengths | 50.37 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 70.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 20.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6J7E0 | 17-194 | YSPLPTPWPMKSDCASRTYRQSDEGPILAWDPYFGMNIDSGAATCFPEAVTSWWFQTVSQATSIALGPTFECPQLYTAAQTLLEAGG… |
| A0A2J6SAI8 | 3-194 | VPALTTTFTPSPSCLVDLYQYPYTSITCYEGTIPVSCQYVQLGPPSTSACFPPGWSPASTIYFSPGICPSGYGVACAETIVTGTLPE… |
| A0A319DTS3 | 2-168 | None |
| N4VF95 | 20-219 | None |
| A0A6A5Y5L9 | 79-361 | None |
| A0A167R7E5 | 27-340 | None |
| A0A162JMN0 | 34-356 | None |
| A0A6G1IPC8 | 11-202 | None |
| A0A1B8EJW6 | 201-365 | None |
| A0A4Q4VZQ3 | 19-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.