DPCstruct | MC6333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 123 ± 12 aa |
| Standard deviation of domain lengths | 11.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G2HZ28 | 298-411 | GRMLKMLLERGVRPDAPGYVFTPLQFAVGNLEDRWVYDLLYEGADPNAVGSADGVHPFGAGHDIMGHLPPLEICKVTKPEWLQSEGD… |
| A0A2J6S599 | 1-138 | MPSHEFEEPACEDTCILPRLLQNGANPDPSGFQVTPLQIAVHARDLAGVNALLEAGADPNNTGDAQGVYWDPKTSVLGPYTKLRGLA… |
| A0A2V1B6U8 | 128-248 | None |
| A0A6G1IHM5 | 136-262 | None |
| G2Q4K1 | 1099-1241 | None |
| A0A2J6PLK7 | 314-439 | None |
| A0A1Y2WFD7 | 904-1020 | None |
| B2AAS1 | 2-104 | None |
| A0A4Q4VUP6 | 57-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.