DPCstruct | MC63329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 124 ± 8 aa |
| Standard deviation of domain lengths | 7.59 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 17.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839NN26 | 1-132 | MFNYNNLIQATDSNIFTLYSSQENCYSFQVNNIRWKQQIGVRYYYYFLNGNKTEITKLLSSFNNNVINFHQSVYIESAFFDNFEQDD… |
| A0A845PP79 | 6-126 | INFKIKAIRWHEKLSHDKSCNYLLDSNQKIIFKELSKANNKIDFFTSCYALSEWNDTYNKVELEMDSRFEQQQKTLRKINSEMSSFL… |
| A0A2W5LN54 | 13-134 | None |
| A0A844A6V6 | 34-150 | None |
| A0A7V2X6D6 | 170-287 | None |
| A0A817TXP2 | 203-322 | None |
| A0A2V4E101 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.