DPCstruct | MC63327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 202 ± 32 aa |
| Standard deviation of domain lengths | 31.63 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P1HFE8 | 6-224 | SAAAIAVTFQHLMSSAKAEWTLEQRLVCDALRRSKASLNDATDGQLAAYLCELEPAQLQGVASNVKGIFHELLVAHMENTDGDAVSA… |
| A0A1B9APV5 | 183-361 | ANQEVIETLKYRNNKEFGDMDLMSIGNRLMENSQTTYASHFAGQKAEFLAKEFLEEKGYNVNLFENRNHPNDDLIAVNPETGEETLY… |
| A0A7K1ZHL5 | 41-252 | None |
| A0A3D9HH67 | 12-259 | None |
| A0A1H5XNG1 | 36-261 | None |
| A0A2E3XQL1 | 51-257 | None |
| A0A1Y5FAC9 | 40-206 | None |
| A0A4P7JB81 | 9-184 | None |
| A0A3N5Y5B8 | 372-545 | None |
| A0A3C1IKX5 | 126-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.