DPCstruct | MC63323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 148 ± 14 aa |
| Standard deviation of domain lengths | 13.72 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A6D1I1 | 2-182 | TPDVRTLSDFVDPGGAMLGFLVPLFGDRRSNAPLVQIIGDDGTIRGFEPYEVPDATTLRAPHLVVRAGDHAVHAFAFGRHDVVLVAD… |
| A0A1I0U620 | 7-154 | SSPSMTLLAYELLADHGLALPLFGSSVSANALHVAVPSRPGDPTTDIHDFEVYSATSPITLDVSLHRIATIGTVWVDVFVWDDVVHV… |
| A0A1C5RTU6 | 2-138 | None |
| A0A0Q4IY82 | 1-148 | None |
| A0A7W4MM81 | 12-138 | None |
| A0A257ZUU6 | 5-141 | None |
| X6FLK2 | 1-168 | None |
| A0A503Q364 | 3-146 | None |
| A0A527V1U9 | 1-141 | None |
| B7KXW0 | 9-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.