DPCstruct | MC63320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 96 ± 12 aa |
| Standard deviation of domain lengths | 11.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q08RD5 | 101-204 | LGQLQEDEVSPERKEKLLAAIDAIRFIAASGQSYDFEDYRKSLDANAPPLVIASFETRDEAEAWLKAHPRPPLGAQVLVANEYHRII… |
| A0A2T4VGB7 | 200-298 | TPRVDWAELLRKTFDFESGQLHSFERFLGNVDSEEPTLPLCSFGTRQEADTWLSAHPRPPHGARVEIAGQSYSVGYSRDSGLRVLVR… |
| A0A4Q6A2D1 | 2-105 | None |
| A0A3A8IIL7 | 9-103 | None |
| S9P406 | 42-141 | None |
| A0A2T4VGB4 | 3-112 | None |
| E3G0I3 | 13-127 | None |
| A0A2T4VBZ0 | 36-120 | None |
| E3FEU5 | 14-112 | None |
| S9NWS6 | 13-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.