DPCstruct | MC6331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 203 ± 41 aa |
| Standard deviation of domain lengths | 41.41 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 23.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5SBH9 | 6-198 | RIRHDLLNRLRWDVLAPISSITILCAPYEENIYLPFFSHPAAEESLASPPLSRISAYSRDISMNEDLDMDSDEEDQYKGPANLTINN… |
| A0A2J6RX49 | 19-256 | QPAQYPTDKELRSSGVSPHSTLATVRLVWSFSGSLETSISVMASAYNVDVLEPYFQPAAGGGSPWHVISKSSLTHPPVSAIVATVDD… |
| A0A178EHE5 | 1-238 | None |
| A0A5N5PV21 | 30-256 | None |
| A0A1J7IN75 | 1-267 | None |
| A0A179I718 | 17-249 | None |
| A0A0A1TM30 | 60-228 | None |
| A0A0A1TNC9 | 2-164 | None |
| A0A6A6G1M4 | 1-170 | None |
| G4UV51 | 1-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.