DPCstruct | MC63306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 127 |
|---|---|
| Mean domain length (aa) | 204 ± 36 aa |
| Standard deviation of domain lengths | 35.91 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.20 |
| Pfam Score | 64.92 |
| Assigned Pfam label(s) | CL0023- PF08343- PF03477- CL0339- PF00317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A101HZL8 | 2-200 | LKVIKRDNTVQYFDQQKIINAITQAMRETIKGVDQELATRIAQKIEQDLKDSVESVTVADIQERVETELMNSERKEVAKVYILYREQ… |
| A0A243A247 | 4-225 | IELNNEITQMQDGFYQLHKDKEALEVFMEEARENTVHFNSVAERMEYMKEHDYYYNVLDEYSLEEVEGVYNIAYGENFEFQSYMAAS… |
| A0A377E4P8 | 8-233 | None |
| E7FHX6 | 3-222 | None |
| A0A1I7G7B7 | 48-378 | None |
| A0A565BNK6 | 344-577 | None |
| E7GEL9 | 12-254 | None |
| A0A6C0JT28 | 2-227 | None |
| A0A1V3WGW3 | 8-224 | None |
| A0A2E3WKT6 | 8-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.