DPCstruct | MC633
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 180 ± 21 aa |
| Standard deviation of domain lengths | 20.53 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A558RCA5 | 13-201 | TPWGKADTATERLPGVFQVTTPSHGGFILYDERQAAMPDALRLDAPAYEEDVNWSLAVIAFAEELAAAGDHLTKIEIDLAHQTARNW… |
| A0A2K9DBA2 | 2-167 | KLSPGRNKMIPLPLRNSSGWYEEDCEINIPLRYFPAEFAALPHKRDRWTPESLQADSDQSIKDRFPDKWEVANGRELEPGESRQKDI… |
| A0A068T1P5 | 48-189 | None |
| A0A8A3LP37 | 89-283 | None |
| A0A1U9LIJ2 | 184-360 | None |
| A0A4R3RST9 | 96-291 | None |
| A0A7X8YB44 | 94-277 | None |
| A0A855KI97 | 120-306 | None |
| I9NGK9 | 4-172 | None |
| A0A850QIH3 | 3-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.