DPCstruct | MC6329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 128 ± 26 aa |
| Standard deviation of domain lengths | 26.48 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6SA89 | 62-173 | SLKEEVYQPIDHTICFIKKLPPEILLTIVKTLDPVSSACFGLTFKAVYPHHRKVHGKVSLRNWFGDGAYQEYTKDGTMLANYLKDWV… |
| A0A2J6RNN3 | 3-139 | ESSSLLPALSTELLLQIFSHLDPVHSTCLGLACRRLYRVYSLKHKKIPLDAFTYDCPIPNSNLSTMCYLFHHLEDWKPAHLMHCWRC… |
| A0A4Y8D6A0 | 131-288 | None |
| A0A1Q8RMT5 | 1-147 | None |
| A0A2A9PBC0 | 96-241 | None |
| A0A2T3BDS4 | 39-140 | None |
| A0A1L7WC34 | 68-167 | None |
| A0A381L911 | 28-174 | None |
| A0A2T3B830 | 113-221 | None |
| A0A2J6Q5R2 | 19-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.