DPCstruct | MC63285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 216 |
|---|---|
| Mean domain length (aa) | 167 ± 43 aa |
| Standard deviation of domain lengths | 42.66 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 86.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.18 |
| Pfam Score | 99.46 |
| Assigned Pfam label(s) | CL0029- PF02586 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A158L1V0 | 21-193 | EDGQYVVRPMRYQCRLAGKPANYDVKFPGTYNARRDNLEGFWKPLFGHTHGVMLVDVFYENVSKAKWEGTLLEAHDKDENVVLEFRP… |
| A0A2S5TQ51 | 1-115 | CVVPFTSFSEWDAAIKAPAWFALDDSRPLAFFAGIWTPHWTSVRKARTGIETADLFAFLTCEPNAVVAPIHPKAMPVILTTQDEVEM… |
| A0A847E6W1 | 3-101 | None |
| A8J4M2 | 160-361 | None |
| A0A0D3DVB9 | 33-219 | None |
| A0A421JS63 | 5-134 | None |
| A0A1G4QSN6 | 17-158 | None |
| A0A7S4PEI2 | 10-141 | None |
| A0A167LFT1 | 724-921 | None |
| A0A2A2K4Q1 | 32-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.