DPCstruct | MC63284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 158 ± 20 aa |
| Standard deviation of domain lengths | 20.16 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485B3F9 | 1-145 | MSDIALTVSVLALVAVVGLWIGNIKIRGIGFGIGGVLFGGIIVGHFVDQAGITLSSPMLHFIQEFGLILFVYTIGIQVGPGFFASLR… |
| A0A158KVJ9 | 10-156 | ITLSTAGGALIAGIVFGWFRAIHPTFGRIPEPTIWFMNSVGLNVFIAVVGITAGPGFVKGLQQLGVSLFLWGIVATSVPLIIGMLIA… |
| A0A3P3VSL5 | 1-137 | None |
| A0A387H3B0 | 4-166 | None |
| A0A0A0DXG2 | 4-137 | None |
| A0A5Q5GEG5 | 2-116 | None |
| G7VAE9 | 4-155 | None |
| A0A6N8K9I1 | 2-147 | None |
| A0A355G7R3 | 3-124 | None |
| A0A6C9ILQ9 | 5-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.