DPCstruct | MC63277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 111 ± 10 aa |
| Standard deviation of domain lengths | 9.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 35.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J2B312 | 6-111 | VRRLHSSVAARAGSQWRLQQGLAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAQREKFARRVVLLSQEMDAGLQAWQLRQQEK… |
| Q4V7Q1 | 30-145 | LSRTGNRSVHSSTLRCAGQDWRVRRGFARSGSEYGPLTDLPDWSFADGRPAPPWKGQIRRKEEREALARRVVLLSTEMDQGMTNWHK… |
| A0A6J0UXJ8 | 172-291 | None |
| A0A6G0YMT9 | 3-113 | None |
| A0A3B5KQL8 | 1-103 | None |
| A0A814CNM1 | 4-104 | None |
| A0A4W3GNA7 | 5-104 | None |
| A0A5K4F1K2 | 10-117 | None |
| A0A0D9RUM6 | 73-167 | None |
| A0A7J7JPR5 | 15-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.