DPCstruct | MC63275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 105 ± 15 aa |
| Standard deviation of domain lengths | 14.57 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T1D6J5 | 57-155 | WCKQPNFVQGFFLLDRIKTIAAEQPDLGNSDGDLAMLQYTAAGAGARLALLLHHDDAEREYAYDRDFHLSPLREALEEVPKLNGGHI… |
| A0A1H9DZ95 | 162-290 | TNLKRHNFEIWVVTGSLELLYQQVCTEAFGIPEDHIIGIRIKEGADGKLMDECERPLSLEAGKVNAIKKYIGVKPLLAAGNSRGDLE… |
| A0A286EV59 | 63-147 | None |
| A0A653L274 | 157-267 | None |
| A0A7J9QNL8 | 433-537 | None |
| A0A1V5XCV6 | 784-899 | None |
| A0A5C6CU40 | 80-197 | None |
| A0A517Y2B1 | 427-542 | None |
| A0A2D7E6U9 | 8-95 | None |
| A0A090AL54 | 204-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.