DPCstruct | MC63272
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 208 ± 31 aa |
| Standard deviation of domain lengths | 30.77 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 14.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T1D012 | 198-399 | FEWSKIPKDRDINNYYLENLGTNFFKEFTIAISHITKLSRPPDGPYTIKSELEEPLNRMLYANIITAMESYLSDAFIKIVLSNEERL… |
| A0A1N7A0D8 | 25-297 | LPQIDNIIYKTTIEELKWAEEATYKIGEWRDIFRSTYIRWALAINGLHQASKTYSDPKWRRSGKKFIVTGFRMRNEVQIVDAPIAKW… |
| A0A7X4GX24 | 24-205 | None |
| A0A654DGX3 | 8-209 | None |
| A0A4R5N7W9 | 166-364 | None |
| A0A2S5FE80 | 13-223 | None |
| A0A1X7M8J8 | 38-251 | None |
| A0A5D0NG44 | 3-167 | None |
| A0A523QEY2 | 7-250 | None |
| A0A2N5CMW9 | 31-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.