DPCstruct | MC6327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 128 ± 17 aa |
| Standard deviation of domain lengths | 16.64 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2J136 | 2-101 | DVLAERILLDLRNTFKKDPLIDEFDVLPVHESVSNKCPVIHVDHKIALEDWCVKHVYVYAYSKFFAWRKKPYKIDPECFLTWTSAIL… |
| A0A0E0C672 | 17-133 | AQLGEGILHHFEEILHQDPLIDEVGFLHPTQFQSLEHSQTDCWTSEAPECPRRYLWCKDHKLAISMEILPKLYRAARRAYSNSAATK… |
| A0A2I2GNA7 | 1-142 | None |
| A0A1D1XVG7 | 32-168 | None |
| A0A540KPI4 | 1-153 | None |
| K2SAK8 | 3-132 | None |
| F2RRN3 | 1-123 | None |
| A0A0W8CA22 | 544-655 | None |
| A0A4W2HXL2 | 75-192 | None |
| A0A443SWD3 | 3-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.