DPCstruct | MC63264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 142 ± 22 aa |
| Standard deviation of domain lengths | 21.73 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4NZ23 | 1-125 | MDSFLKDCVREFPYRECTTFHQMVSSLTSKDPPPALSVINCTINGQRGFVDAIPYCSTCGEEKPAKKCSKCKSVQYCDRECQRLHWF… |
| A0A7M7RDG9 | 248-380 | IKFLLRARENDGTRVNMEKLLREIIREFPFHESELFVQIVRNLTDVKIGDEPTALGILTQAVNGARSLEVVNPCSTCGEAKASKKCS… |
| A0A834NTA9 | 254-380 | None |
| A0A0B1SN60 | 198-312 | None |
| A0A183RKY9 | 172-296 | None |
| A0A0B2VLU6 | 2-140 | None |
| A0A5K3ERI5 | 95-235 | None |
| A0A5C6NGV5 | 64-253 | None |
| A0A813NR44 | 594-702 | None |
| A0A4Y2A1Y0 | 7-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.