DPCstruct | MC63263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 99 ± 7 aa |
| Standard deviation of domain lengths | 7.30 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 52.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4NWT8 | 1-83 | MIFADKRFSRADKRTKLPRWIQEHLRDSLCNLSTEEAVQISKRWLRQMAQPFTREDQLGVSLLTLAQLQSQEQQDKIEKQVIQ |
| A0A2D4KQ10 | 132-233 | RHAAQCVGRAIRGKTDYGLLIFADKRFARADKRGKLPRWIQEHLTDANLNLTLDEAVQVAKHFLRQMAQPFRQEDQLGLSLLTLEQL… |
| A0A452XYU6 | 29-125 | None |
| A0A452XYK0 | 1-97 | None |
| A0A493TZ73 | 170-271 | None |
| A0A6G3MIM8 | 1-114 | None |
| A0A368EZL8 | 117-212 | None |
| A0A6A2Y0S0 | 74-173 | None |
| A0A183HPI4 | 39-138 | None |
| A0A7S3BXZ5 | 69-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.