DPCstruct | MC6326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 6.32 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.20 |
| Pfam Score | 93.33 |
| Assigned Pfam label(s) | PF01775- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0C5R6 | 3-66 | AFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEV |
| A3DNH6 | 3-74 | EIKIYRVEGVMLLSHDRFPVWQKFTKEVRALNKEQAIEYVYSVLGSNHKLRRKHIRITKIEEITLSEVRDRR |
| Q74NK1 | 1-78 | None |
| A0A5D2JYW6 | 28-110 | None |
| A0A803QES2 | 137-201 | None |
| A0A2K6UA45 | 5-68 | None |
| A0A835JQ25 | 3-69 | None |
| A0A5P1EY33 | 2-68 | None |
| A0A835GZ07 | 4-69 | None |
| A0A337SEX5 | 22-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.