DPCstruct | MC63251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 80 ± 4 aa |
| Standard deviation of domain lengths | 3.75 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 38.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817NGD7 | 1-80 | DAWKNLQIFDRPFLTLFSDSDPITAGAEKFLQMLIPGAKNQAHAIISQAGHFLQEDKPHEIVEHLIKFINDNPLPLYSKR |
| A0A1B6NRY5 | 80-158 | AEAQANRDAGEKLKHYEKPFVTAFGDSDPVTKGGDKIFQKLVPGCKGMPHTTVKNAGHFIQEDKGEELANLLIQFIKQT |
| A0A2D9IJR2 | 317-390 | None |
| A0A3D3UTQ8 | 267-345 | None |
| A0A7Y1ZEE9 | 50-134 | None |
| A0A7C7XPC0 | 56-126 | None |
| A0A1Z9JPX6 | 49-130 | None |
| A0A2D6FV53 | 1-82 | None |
| A0A7C7PGL8 | 244-323 | None |
| A0A1G6V6J8 | 30-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.