DPCstruct | MC63249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 69 ± 4 aa |
| Standard deviation of domain lengths | 3.69 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 59.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K8R9I4 | 1-71 | MTRYARNCTAGAVYPYHEKQKDTQTCGYGTQKMRLGKDAVKDFDCCCLSLQPCRNPVITPDGFLFDKEAIL |
| A0A674HRQ5 | 1-59 | MTRHGKNCTAGAVYSYHERRKDTAASGYGTQRVRVGRDAIKDFDCCCLSLQPCRDPVVT |
| A0A433QHF0 | 1-67 | None |
| A0A2T7PLD5 | 1-71 | None |
| A0A817GFU4 | 1-71 | None |
| A0A804L500 | 2-68 | None |
| A0A0R3VUJ0 | 1-71 | None |
| V9IMG2 | 1-71 | None |
| A0A2A2JET0 | 233-303 | None |
| A0A151IRJ6 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.