DPCstruct | MC63245
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3 |
|---|---|
| Mean domain length (aa) | 217 ± 34 aa |
| Standard deviation of domain lengths | 33.91 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183B512 | 142-360 | IKCSILRDGICKPLAQYGVDKTVVSVFHSCNEKINKEVNLFQAQRRITFAVNPKKWRRLERKQREGFKDPEAIQKAQQIIDDLRNNG… |
| A0A6V7H0K5 | 127-301 | TNNDDSEDQKQRDREIRLNRGRSNAGRYENIKSKQSWKVKLAKYLVNDLKNYGPGNLMHINAISTITGKPIRIWRSKCLHQTINDQT… |
| A0A4R5P2N7 | 75-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.