DPCstruct | MC6324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 82 ± 5 aa |
| Standard deviation of domain lengths | 5.26 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 57.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6PPA3 | 78-152 | MAVADMEYRMQKKAKKKTCKELKEIAYSEGKKPPPNPYPSAIKEIQGEEKKYVMDCLFNLKVIEIANKMKEERRQ |
| A0A0E0BY55 | 1-82 | MAVADMEYAAEKKAKKKAYKELKEIARIEGKRPPPNPYPSAIKEIQAEEKKYVRERFHNPKILEIVKKMKEDKELFFKDREA |
| A0A453KCM7 | 73-161 | None |
| A0A453KBF7 | 161-249 | None |
| A0A3L6PJI2 | 1-77 | None |
| A0A2P6PCR7 | 6-89 | None |
| A0A438H0I4 | 8-78 | None |
| A0A7J8MZ25 | 1-81 | None |
| A0A835DU87 | 150-230 | None |
| A0A4S8JWS4 | 97-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.