DPCstruct | MC63232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 315 ± 76 aa |
| Standard deviation of domain lengths | 75.70 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 40.46 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | CL0357- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A218UKL9 | 19-304 | HSVSYTLSRTQTVIVEYIHDRETDMFQVGRSTESPIDFVVTDTISGNQNTDETQITQSTISRFACRIVCDRIPPYTARIFAAGFDSS… |
| A0A336LUU0 | 51-352 | DTTQHSISYTLSRNQAVIVEYKEDPDTDMFQVGRSSEAPIDFVVMDTLPGDKKDAKVLQSTISRFACRILVDRNEPFKARIYAAGFD… |
| A0A3P6H4S9 | 19-385 | None |
| A0A834XKW6 | 178-525 | None |
| A0A6S8UDS2 | 28-393 | None |
| A0A7S4E7U7 | 84-516 | None |
| A0A669CNP2 | 196-550 | None |
| A0A654H2D3 | 64-507 | None |
| A0A6U1Q779 | 1-166 | None |
| D0MW96 | 312-542 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.