DPCstruct | MC63222
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 445 ± 90 aa |
| Standard deviation of domain lengths | 90.25 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0592 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060HDF4 | 2-530 | DLDGDGIETTGSDGRVILFDHDADGVKTGTGWLKPDDGWLVLDRNGNGTIDSGRELFGTDTVKRNGQLATDGFDALRDVDSNQDGKI… |
| I4WE45 | 2-343 | RDLNGNGLIDSGREMFGSQTLLSNGLLAANGFEALRELDANQDGKVDGADAAFSELRIWRDLDGDGQTDAGELQTLAENGIVGMRTA… |
| A0A2A5H5D3 | 136-490 | None |
| A0A2T5R983 | 85-608 | None |
| A0A3N2E0I2 | 93-645 | None |
| A0A1W9LWJ1 | 14-306 | None |
| A0A1I3HW43 | 434-816 | None |
| A0A7T1HWE9 | 367-861 | None |
| A0A2S6HGM5 | 11-443 | None |
| A0A7W6BI27 | 392-910 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.