DPCstruct | MC6322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 88 ± 13 aa |
| Standard deviation of domain lengths | 12.56 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B6W8U2 | 3-99 | KLWMLNIQGPDDIVAAPSKDEADAVAAAFNTYWGEYLAKQRAQSVADGHDPDHWPTVTAVVIEWDGTAAEHTESIAKYWPEYAEYLK… |
| A0A0A0EI86 | 14-83 | TLWCVHVLGPDDVHAVPSHDAAVIGARELNKAIHGKAEAPEDILCFAYAAPWPHSAEAHAEDLKREGDAP |
| A0A1T3VK31 | 95-182 | None |
| A0A437M185 | 102-180 | None |
| A0A166EFQ5 | 93-200 | None |
| A0A1H7BVR4 | 47-125 | None |
| A0A4R7FV63 | 2-99 | None |
| A0A5C1DFY6 | 1-118 | None |
| J3HUQ3 | 17-99 | None |
| A0A2Z5MJ48 | 4-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.