DPCstruct | MC63216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 122 ± 18 aa |
| Standard deviation of domain lengths | 18.13 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.00 |
| Pfam Score | 98.10 |
| Assigned Pfam label(s) | CL0511- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A218ZCI3 | 3-95 | PSFPITPAPLCYLASCRAQATRKNVYDGNANGHRGRPYYYCDQHHARKFVTFDDSTGVAPGNPTCRCGYISRRGLTNAPPKKEFFKC… |
| A0A6A6C6X5 | 2-122 | PLQDMLESPETPSPVLAKEEEHPCTECGKQRSRRGSVASSPRHANAGRTYFPCTNSRCRKGSARLMQRDFVTWDAHGENPKCDCGLP… |
| A0A068V7Z7 | 1-119 | None |
| A0A1V6SI92 | 8-109 | None |
| A0A815VW33 | 6-180 | None |
| A0A835JTQ4 | 97-215 | None |
| A0A034W0P3 | 101-272 | None |
| A0A5J5V1Q1 | 62-180 | None |
| A0A6P8C9Z5 | 137-254 | None |
| A0A1L9U1I1 | 66-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.