DPCstruct | MC63213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 155 |
|---|---|
| Mean domain length (aa) | 458 ± 83 aa |
| Standard deviation of domain lengths | 82.96 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 16.94 |
| Pfam Score | 90.28 |
| Assigned Pfam label(s) | CL0159- CL0570- PF18425- CL0364- PF00082 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A524B2V2 | 30-464 | VDYGVDCLHPSIEQSVLAVLDDDANVVWQRDRELLPLDSLPASLISDAKGHGTHIAASLVGRGAVRGVAPEASLVVAKAGTDDRIVA… |
| A0A7C2J862 | 4-354 | IVHDLAPGAELWFAGFGGTSGTALDFNAAVNCLAQRVDVVVDDVNWFNAGPYDGSSIVSRNTAAALNSPTNRVRAHVTAVGNQAAAH… |
| A0A4Q3Y3J6 | 78-586 | None |
| A0A2P9IP31 | 55-567 | None |
| A0A453DN76 | 61-524 | None |
| A0A535AHM3 | 80-555 | None |
| A0A1Y2H8W5 | 321-808 | None |
| A0A517NWP7 | 138-672 | None |
| A0A3B8LRW4 | 194-668 | None |
| A0A6L9IM95 | 370-769 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.