DPCstruct | MC63210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 93 ± 10 aa |
| Standard deviation of domain lengths | 10.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 51.25 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | CL0067- PF03169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A699H5V4 | 7-103 | NALMGAECIDYIDEALRAAKDTTINSDGKNAVPDVWQLLDKIKELSDKVRNGSSVEATRKALTNVIAIGIGGSFLGTLFVHTALRTS… |
| A0A6N4D6B6 | 2-83 | RNRSNTPIILDGEDVMPAVNAVLEKMKSFTNRIVSGEWKGYTGKEITDIVNIGIGGSDLGPYMVTEALKPYKTRLNMHFVSN |
| D0WCG3 | 76-170 | None |
| A0A0L0SND3 | 7-96 | None |
| A0A0F7TW35 | 159-249 | None |
| A0A7J7ZYA1 | 20-113 | None |
| A0A485ATX3 | 185-278 | None |
| A0A816J597 | 433-522 | None |
| A0A7J7M022 | 87-189 | None |
| A0A7J7MDB4 | 107-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.