DPCstruct | MC6321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 245 ± 36 aa |
| Standard deviation of domain lengths | 35.80 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 26.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428I550 | 117-381 | TWFFDIFLTNQYGIDWIHFDVPSISETTGNKTATLFRIEESLRKQYKLLSEEGLIDVNLYNITSTPSIESLQSFTKRKYFSMNNSDN… |
| A0A2E9T0A4 | 1-239 | MKQYKLFVENGHIDFELLQMSSGPTAIKVIPSLNSNKYIYINKDDQGVNFLTYLLFSDQTLLTYVDPFKDKQYRNFVDLLVNEEEIN… |
| A0A2N8PWR5 | 375-651 | None |
| A0A090WNI2 | 129-302 | None |
| A0A3G5T8W7 | 49-323 | None |
| T0U3D1 | 2-254 | None |
| A0A1H4C5B2 | 368-651 | None |
| A0A1Y4HQY9 | 279-467 | None |
| J9G767 | 23-248 | None |
| A0A3A8Y7F4 | 231-505 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.