DPCstruct | MC63206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 41 ± 2 aa |
| Standard deviation of domain lengths | 1.91 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.97 |
| Mean intra-cluster sequence similarity (%) | 74.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818LZK3 | 1-40 | MPKYYCDYCDTYLTHDSPSVRKTHCQGRKHKENVRDYYQK |
| A0A6P5LAV0 | 1-40 | MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQK |
| A4RSN6 | 1-46 | None |
| A0A7J6E304 | 492-530 | None |
| A0A183FCP6 | 37-75 | None |
| A0A843UT05 | 226-265 | None |
| A0A183HKV6 | 1-40 | None |
| A0A1R3GNV4 | 39-78 | None |
| A0A2H5TGL8 | 1-41 | None |
| A0A5C5G622 | 1-41 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.