DPCstruct | MC63205
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 166 ± 16 aa |
| Standard deviation of domain lengths | 15.74 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.43 |
| Pfam Score | 80.00 |
| Assigned Pfam label(s) | PF02825- CL0229- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A507F2V2 | 1-159 | MCYQTRVSAKDLAYKWEWAPNPEQWIPYDTPTAALIEQAFSSRLKSTTLNVGPYFMMYPRTYTFHFDYENGNCYQRNKSSDMCRTAR… |
| A0A2Z6SIR0 | 27-190 | MCFLTRTDAKDLPVQWEWRANPDQWIPYDLASSSELEDSYQRKKAVIVPKQGYFATVPDRYEVRFNYTTGRFQQYNLSSGGTRRVRR… |
| A0A7S0AGZ2 | 16-197 | None |
| A0A6A5C5Z0 | 835-998 | None |
| R1DU43 | 127-310 | None |
| A0A2P6N0R1 | 364-541 | None |
| A0A7S4P040 | 94-237 | None |
| A0A7S4RB00 | 467-621 | None |
| A0A7R9ZVS8 | 15-166 | None |
| A0A7S0FE42 | 191-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.