DPCstruct | MC63200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 102 ± 11 aa |
| Standard deviation of domain lengths | 11.37 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A318SJE1 | 28-116 | MYAIAFDLDTQALQAAYPGPSYNNAYGEIKKILVARGFAWQQGSVYFGNETITAVQCVLSAQALSAALPWFKASVRDLRMLRIEELN… |
| A0A0Q6EIY6 | 2-95 | YAIAFDFDTEILERLYPNPSWRNAYSDVRTFLEENGFEHRQGSVYFGDPELSAPECIAIVEDMADEFAWFTASLKDIRMLRIEENND… |
| A0A0S4PWF3 | 6-91 | None |
| A0A413UBI7 | 2-98 | None |
| A0A1X1Q449 | 20-116 | None |
| A0A3E3DVG6 | 7-107 | None |
| A0A350VZB2 | 9-109 | None |
| A0A2P6MYC9 | 162-282 | None |
| A0A2D5EPL9 | 1-102 | None |
| A0A3A6JJS4 | 2-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.