DPCstruct | MC632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 106 ± 18 aa |
| Standard deviation of domain lengths | 17.76 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 93.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17392 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V4TBW3 | 27-121 | NRETESMKDGSDAVSDWPLLNALLNTAGGASWVSLHHGGGVGMGFSQHAGVVIVADGTQAAHERLGRVLLNDPATGVMRHADAGYEL… |
| A0A0B4DUJ2 | 12-115 | VASPYRETEAMADGSDAVADWPILNALLNTASGATWVSLHHGGGVGIGRSIHAGQVSVADGTPLAAEKLERLLTNDPGMGVIRHVDA… |
| R1CEL0 | 2-89 | None |
| A0A212C8T7 | 189-297 | None |
| A0A3P9KAA8 | 547-666 | None |
| A0A7M4A3M2 | 15-101 | None |
| A0A556TR47 | 454-574 | None |
| W4SL99 | 438-552 | None |
| A0A644ZMP9 | 111-222 | None |
| A0A535YS62 | 906-1020 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.