DPCstruct | MC63195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 359 |
|---|---|
| Mean domain length (aa) | 171 ± 30 aa |
| Standard deviation of domain lengths | 30.40 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 19.15 |
| Pfam Score | 97.55 |
| Assigned Pfam label(s) | CL0649- CL0123- CL0124- PF04675- CL0193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T5RKB2 | 8-137 | LLTLAEDAGLEVDILNGRPGVYTARYAPGTDEDRYRKLLSELQNVSEEKRTARFRATIAIYDPSNDKVRTCEGIYEGRIALEPIGNN… |
| A0A2E1VHV0 | 4-173 | ALILASESQYKKNILERLEIAFSTEAPAINETPRPGESARALSSRLAQRKAEKIAARYPDAIVISTDQSAEVHGVILGKPATIENAR… |
| A0A6J5VP47 | 50-220 | None |
| A0A837PZM3 | 5-141 | None |
| A0A7X9KYT3 | 240-426 | None |
| A0A2E4HLK0 | 10-190 | None |
| F8JFF8 | 6-194 | None |
| A0A7R9A6X4 | 29-131 | None |
| A0A1Y2HAF1 | 218-414 | None |
| A0A0G4H097 | 24-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.