DPCstruct | MC63191
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 142 ± 19 aa |
| Standard deviation of domain lengths | 18.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05255 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6QV93 | 5-144 | ALLWGIIGPGVAGAVFGAGWWFWVDAVVCSAVPVSFLHYLPGIFASLAALMFNCVNKDEIGYDYYSPYGDDSEWRVKLWLFVAYVVS… |
| A0A7J8P8V8 | 5-122 | ELWAIFGPGVAGAVFGAGWWFWVDAVICSSVNVSFVHYLPGIFASIAALMFNCVRKEDIDYSPYDEGEWRLKLWLFFAYVVSFVSLA… |
| A0A409WFE0 | 550-712 | None |
| A0A177B2B1 | 4-155 | None |
| A0A7S1QB55 | 6-142 | None |
| A0A367KPE0 | 2-113 | None |
| A0A3P8YII7 | 1-125 | None |
| A0A5F4CDZ3 | 41-142 | None |
| A0A6A4HV54 | 8-151 | None |
| A0A3B6KJD6 | 4-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.