DPCstruct | MC63189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 93 ± 14 aa |
| Standard deviation of domain lengths | 14.12 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 45.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6QJD1 | 2-100 | YLLSTCDVLVTSGFSTFGYVAQGLAGRRPWVMPRPSPWEEWAEGQAPAEPPCRRAPSVEPSFHSPSYYDCAARRDVELDKVAPYIRR… |
| A0A0A9R0L6 | 11-102 | YLLSLSDVMVTSAWSTFGYVAQGLSGLKTWLMFKPENRTAPDPPCRQVLSMEPCFHAPPFYDCKARRGTDTGKLVPHVRHCEDMSWG… |
| A0A388LG53 | 629-743 | None |
| A0A7I3Z0U1 | 18-117 | None |
| M7YMN0 | 400-502 | None |
| A2YAL8 | 73-176 | None |
| A0A6A2YDQ3 | 293-360 | None |
| A0A6V7P624 | 279-381 | None |
| A0A811PJ74 | 117-218 | None |
| A0A3L6QPB4 | 175-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.