DPCstruct | MC63188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 134 |
|---|---|
| Mean domain length (aa) | 131 ± 21 aa |
| Standard deviation of domain lengths | 21.06 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.26 |
| Pfam Score | 98.51 |
| Assigned Pfam label(s) | CL0207- PF00183- PF16712 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6QAT1 | 327-465 | CERVERVVVSDRLGDSTCCVITAKTEKIMRAQQLSSPSLLGYVTKLTMEINPVSPVMKKLRKRAEANRNDKFVKDTVILLFETTLLT… |
| A0A7Y0WYQ7 | 26-147 | KETEEEFKSVVERTKSYLGDRVKDVRTTFKLASTPAVVVTDDYEMGTQMAKLLAAAGQAVPEVKYIFEINPEHELVKRMADEADEEA… |
| R7UAU2 | 2-86 | None |
| A0A2V2W6U6 | 18-148 | None |
| M1A3V7 | 125-238 | None |
| A0A6I8NVF5 | 203-346 | None |
| K8EXD6 | 1056-1206 | None |
| A0A7S1XR15 | 1-116 | None |
| A0A1R3L475 | 232-361 | None |
| A0A226F3D9 | 432-580 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.