DPCstruct | MC63181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 7.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A091C467 | 23-118 | VDTTIRITNTYKLTSREFHPQNTVVDVEGMKIGDGNFITMAGPCSVEGLEQIRQTAQIAKMGGAQILRGGAFKTSNVTLRFSRTGRR… |
| N1LZ80 | 95-160 | LVSRKKKTEDTIVEINGEKIGDGNQHFIMGPCAVESYEQVRQVAEAMKGQGLKLMRGSAFKPRTSP |
| W9ECI0 | 56-141 | None |
| W4V7B5 | 1-85 | None |
| A0A533IU68 | 96-177 | None |
| A0A5J4KSP1 | 1-89 | None |
| T0M191 | 51-126 | None |
| A0A1W9NW86 | 63-158 | None |
| A0A7V6MHK7 | 60-137 | None |
| E6QDZ1 | 56-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.